Mouse UTER protein (Active)

SKU: orb359274

Description

This Mouse UTER protein (Active) spans the amino acid sequence from region 22-96aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of ＞ 200 IU/m.
• Tag: Tag-Free
• Molecular Weight: 8.4 kDa
• Expression Region: 22-96aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl
• Disclaimer: For research use only

Alternative Names

Clara cell 17 kDa protein, CCPBP, Clara cells 10 kDa secretory protein, CC10, PCB-binding protein

Quick Database Links

UniProt

Q06318