You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359274 |
---|---|
Category | Proteins |
Description | Recombinant mouse UTER active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 98% as determined by SDS-PAGE and HPLC. |
MW | 8.4 kDa |
UniProt ID | Q06318 |
Protein Sequence | DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Expression System | Expression Region: 22-96aa. Protein Length: Full Length of Mature Protein |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/m. |
Expression Region | 22-96aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl |
Alternative names | Clara cell 17 kDa protein, CCPBP, Clara cells 10 k Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating