You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Trem2 protein
Catalog Number: orb358927
| Catalog Number | orb358927 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Trem2 protein |
| Tag | N-terminal 6xHis-Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 20.8 kDa |
| UniProt ID | Q99NH8 |
| Protein Sequence | LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS |
| Protein Length | Extracellular Domain |
| Source | Mammalian cell |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 19-171aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Triggering receptor expressed on monocytes 2 Read more... |
| Note | For research use only |
| Application notes | Full length of HIS-tag and expression region is 20.93kDa |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse TREM2 Protein, hFc Tag [orb1826803]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 42.9 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Mouse Trem2 protein [orb358438]
Greater than 90% as determined by SDS-PAGE.
20.8 kDa
E.coli
20 μg, 100 μg, 1 mg 
Mouse TREM2 protein [orb707299]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgMouse TREM2 protein [orb707300]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgMouse Triggering Receptor Expressed on Myeloid Cells 2b protein [orb334458]
500 μg, 1 mg, 50 μg, 10 μg
