You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358927 |
---|---|
Category | Proteins |
Description | Recombinant mouse Trem2 protein |
Tag | N-terminal 6xHis-Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 20.8 kDa |
UniProt ID | Q99NH8 |
Protein Sequence | LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS |
Protein Length | Extracellular Domain |
Source | Mammalian cell |
Expression System | Expression Region: 19-171aa. Protein Length: Extracellular Domain |
Expression Region | 19-171aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Triggering receptor expressed on monocytes 2 Read more... |
Note | For research use only |
Application notes | Full length of HIS-tag and expression region is 20.93kDa |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
20.8 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 42.9 kDa after removal of the signal peptide. | |
Mammalian |
Unconjugated | |
95% | |
43.9 kDa | |
Human TREM2, Fc Tag (orb750345) is expressed from human 293 cells (HEK293). It contains AA His 19 - Ser 174 (Accession # Q9NZC2-1). |
Filter by Rating