You have no items in your shopping cart.
Cart summary
Mouse Tnfrsf10b protein
Catalog Number: orb594858
| Catalog Number | orb594858 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Tumor necrosis factor receptor superfamily member 10B(Tnfrsf10b),partial (Active) |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 40.9 kDa |
| UniProt ID | Q9QZM4 |
| Protein Sequence | NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS |
| Protein Length | Partial |
| Source | Mammalian cell |
| Expression System | Expression Region: 53-177aa. Protein Length: Partial |
| Biological Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TRAIL is less than 1 ug/ml. |
| Expression Region | 53-177aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
Mouse TNFRSF10B protein [orb707189]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman TNFRSF10B Protein, mFc Tag [orb689451]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.5 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgMouse TNFRSF10B protein [orb392585]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgMouse TNFRSF10B Protein, hFc Tag [orb1290884]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.3 kDa after removal of the signal peptide. The apparent molecular mass of mTNFRSF10B-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μgMouse TRAIL R2 / DR5 / TNFRSF10B Protein [orb570303]
Unconjugated
90%
16.1 kDa
Mouse TRAIL R2, His Tag (orb570303) is expressed from human 293 cells (HEK293). It contains AA Asn 53 - Lys 180 (Accession # Q9QZM4-1).
100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars