You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Tnfrsf10b protein
Catalog Number: orb594858
| Catalog Number | orb594858 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Tumor necrosis factor receptor superfamily member 10B(Tnfrsf10b),partial (Active) |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS |
| Protein Length | Partial |
| UniProt ID | Q9QZM4 |
| MW | 40.9 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 92.04 ng/ml in the presence of 40 ng/mL of TNFSF10. |
| Expression Region | 53-177aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human TNFRSF10B Protein, mFc Tag [orb689451]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.5 kDa after removal of the signal peptide.
Mammalian
100 μg, 50 μg, 10 μg - Item 1 of 1
Mouse TNFRSF10B Protein, hFc Tag [orb1290884]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.3 kDa after removal of the signal peptide. The apparent molecular mass of mTNFRSF10B-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 2
- Item 1 of 2
- Item 1 of 2
TNFRSF10B (7F4) Mouse mAb [orb1563339]
ICC, IF, WB
Human, Mouse
Monoclonal
Unconjugated
100 μl, 50 μl, 20 μl
