You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605277 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Tenascin(Tnc),partial |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN |
Protein Length | Partial |
UniProt ID | Q80YX1 |
MW | 28.8 kDa |
Application notes | Partial |
Endotoxins | Not test. |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 1884-2099aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Hexabrachion Tenascin-C Short name, TN-C Hxb |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Tnc was greater than 95% as determined by SEC-HPLC
Greater than 85% as determined by SDS-PAGE. | |
28.8 kDa | |
Baculovirus |
Greater than 85% as determined by SDS-PAGE. | |
26.8 kDa | |
Yeast |
> 85% as determined by SDS-PAGE | |
27 kDa |
94.00% | |
46.5 kDa (predicted) |
> 95% | |
65.65 kDa (predicted). Due to glycosylation, the protein migrates to 70-80 kDa based on Tris-Bis PAGE result. |