Mouse TGF beta 1 protein

SKU: orb594765

Description

This Mouse TGF beta 1 protein spans the amino acid sequence from region 279-390aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  Full Length of Mature Protein

Key Properties

• Source: Mammalian cell
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-25 pg/ml.
• Tag: Tag-Free
• Molecular Weight: 12.8 kDa
• Expression Region: 279-390aa
• Protein Length: Partial
• Protein Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 4 mM HCl
• Disclaimer: For research use only

Alternative Names

TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP;latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P04202