Mouse TGF beta 1 protein

Catalog Number: orb594765

Catalog Number	orb594765
Category	Proteins
Description	Recombinant Mouse Transforming growth factor beta-1(Tgfb1) (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	12.8 kDa
UniProt ID	P04202
Protein Sequence	ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Protein Length	Partial
Source	Mammalian cell
Expression System	Expression Region: 279-390aa. Protein Length: Partial
Biological Activity	The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-25 pg/ml.
Expression Region	279-390aa
Endotoxins	Less than 0.01 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 4 mM HCl
Alternative names	TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Item 1 of 1

Conjugation:	Unconjugated
Purity:	90%
MW:	15.9 kDa
Source:	Human R-Spondin 3 (22-146), His Tag (orb257810) is expressed from human 293 cells (HEK293). It contains AA Gln 22 - Val 146 (Accession # AAH22367.1).

Sizes Available: 1 mg, 50 μg