You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594765 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Transforming growth factor beta-1(Tgfb1) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Protein Length | Partial |
UniProt ID | P04202 |
MW | 12.8 kDa |
Application notes | Full Length of Mature Protein |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-25 pg/ml. |
Expression Region | 279-390aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
IF, IHC-Fr, IHC-P | |
Human | |
Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |