You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-25 pg/ml. |
| Tag | Tag-Free |
| Expression Region | 279-390aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 12.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP;latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1
Similar Products
−- Item 1 of 1
Mouse Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) ELISA Kit [orb781040]
Mouse
0.16-10 ng/mL
0.056 ng/mL
96 T, 48 T 
Recombinant Mouse FSTL1 Protein [orb2994352]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 59.6 KDa. Observed: 70-85 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse FSTL1 Protein [orb2994353]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 33.5 KDa. Observed: 45-58 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse Latent TGF-beta 1 Protein (Biotin) [orb2993080]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 12.8&31.7 KDa. Observed: 13&35-45 KDa, reducing conditions
100 μg, 20 μgRecombinant Mouse Latent TGF-beta 1 Protein [orb2993082]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 12.8&31.7 KDa. Observed: 12&35-45 KDa , reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Mouse TGF beta 1 protein (orb594765)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks