You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419147 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Sulfotransferase 1A1 |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI |
Protein Length | Full Length |
UniProt ID | P52840 |
MW | 39 kDa |
Application notes | Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Full Length of Mature Protein |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 1-291aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Aryl sulfotransferase Phenol sulfotransferase Phen Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
54 kDa | |
E.coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
31.9 kDa | |
E.Coli |
WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
98.00% | |
39.0 kDa (predicted) |