You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358722 |
---|---|
Category | Proteins |
Description | Recombinant mouse Scgb3a2 protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 15.2 kDa |
UniProt ID | Q920H1 |
Protein Sequence | LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL |
Protein Length | Full Length of Mature Protein of Isoform C |
Source | Yeast |
Expression System | Expression Region: 22-139aa. Protein Length: Full Length of Mature Protein of Isoform C |
Expression Region | 22-139aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Pneumo secretory protein 1 Short name, PnSP-1 Uter Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
43.2 kDa | |
E.coli |
Mouse | |
9.4 pg/mL-600 pg/mL | |
2.35 pg/mL |
Unconjugated | |
90% | |
47.0 KDa | |
Mouse MARCO, His Tag (orb762402) is expressed from human 293 cells (HEK293). It contains AA Gln 70 - Ser 518 (Accession # Q60754-1). |
Mouse | |
5-1000ng/L | |
2.15ng/L |
Filter by Rating