You have no items in your shopping cart.
Mouse Reg3g protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 18.3 kDa |
| Expression Region | 27-174aa |
| Protein Length | Full Length |
| Protein Sequence | EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse Regenerating Islet Derived Protein 3 Gamma (REG3g) ELISA Kit [orb779999]
Mouse
31.25-2000 pg/mL
11.3 pg/mL
96 T, 48 TRecombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), partial [orb2658512]
Greater than 95% as determined by SDS-PAGE.
23.3 kDa
E.coli
100 μg, 1 mg, 20 μgRecombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), partial [orb2659684]
Greater than 85% as determined by SDS-PAGE.
16.5 kDa
E.coli
1 mg, 100 μg, 20 μgReg3g (NM_011260) Mouse Recombinant Protein [orb3042793]
> 80% as determined by SDS-PAGE and Coomassie blue staining
19.8 kDa
100 μg, 1 mg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse Reg3g protein (orb245973)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




