You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1477841 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Retinol-binding protein 4(Rbp4) (Active) |
Tag | C-terminal hFc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 94% as determined by SDS-PAGE. |
MW | 50.3 kDa |
UniProt ID | Q00724 |
Protein Sequence | ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Expression System | Expression Region: 19-201aa. Protein Length: Full Length of Mature Protein |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr (CSB-MP025270MO) at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL. |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Alternative names | (Plasma retinol-binding protein)(PRBP)(RBP) Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
IHC-P | |
Goat, Human, Monkey, Mouse, Rabbit, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Mouse | |
0.312 μg/mL-20 μg/mL | |
0.078 μg/mL |
Mouse | |
0.63-40ng/mL | |
0.38 ng/mL |
Filter by Rating