You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594768 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Platelet-derived growth factor subunit B(Pdgfb) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 13.4 kDa |
UniProt ID | AAH53430.1 |
Protein Sequence | SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/c3T3 mouse fibroblast cells is 1.55 ng/ml. |
Expression Region | 82-190aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
Alternative names | Platelet-Derived Growth Factor Subunit B; PDGF Sub Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. | |
Escherichia Coli |