Mouse PDGF B protein

Catalog Number: orb594768

Catalog Number	orb594768
Category	Proteins
Description	Recombinant Mouse Platelet-derived growth factor subunit B(Pdgfb) (Active)
Tag	C-terminal 6xHis-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	13.4 kDa
UniProt ID	AAH53430.1
Protein Sequence	SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 82-190aa. Protein Length: Full Length of Mature Protein
Biological Activity	The ED50 as determined in a cell proliferation assay using Balb/c3T3 mouse fibroblast cells is 1.55 ng/ml.
Expression Region	82-190aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 4 mM HCl
Alternative names	Platelet-Derived Growth Factor Subunit B; PDGF Sub Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Mouse PDGF B protein [orb707263]
Applications:
ELISA, MS, SDS-PAGE, WB
Purity:
Greater than 95% as determined by reducing SDS-PAGE.
Source:
E. coli
Sizes Available: 500 μg, 50 μg, 10 μg
Mouse Platelet-derived Growth Factor Subunit B Protein [orb1475269]
Source:
E.coli
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg
Mouse PDGF-A protein [orb669400]
Source:
E. coli
Sizes Available: 10 μg, 500 μg, 50 μg
Mouse PDGF-B protein [orb669401]
Source:
E. coli
Sizes Available: 10 μg, 500 μg, 50 μg
Mouse PDGF BB Protein [orb429457]
Sizes Available: 1 mg, 10 μg, 2 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	E. coli