You have no items in your shopping cart.
Cart summary
Mouse Ngf protein
Catalog Number: orb594762
| Catalog Number | orb594762 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Beta-nerve growth factor(Ngf),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 12.4 kDa |
| UniProt ID | P01139 |
| Protein Sequence | MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | Expression Region: 130-239aa. Protein Length: Partial |
| Biological Activity | Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 70 ng/ml. |
| Expression Region | 130-239aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 8.0. |
| Alternative names | Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
Mouse Klk1b22 protein [orb358147]
Greater than 90% as determined by SDS-PAGE.
41.8 kDa
E.coli
20 μg, 100 μg, 1 mgMouse NGF protein [orb392186]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgMouse NGF protein [orb392187]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
