You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594762 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Beta-nerve growth factor(Ngf),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 12.4 kDa |
UniProt ID | P01139 |
Protein Sequence | MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 130-239aa. Protein Length: Partial |
Biological Activity | Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 70 ng/ml. |
Expression Region | 130-239aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 8.0. |
Alternative names | Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
41.8 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Filter by Rating