Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 1 to 3 weeks
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00Product Overview
Product Name | Mouse Lgals6 protein |
---|---|
Catalog Number | orb244341 |
Species/Host | Mouse |
Conjugation | Unconjugated |
Target | Lgals6 |
Alternative Names | (click to expand) |
Product Properties
Form/Appearance | Tris-based buffer, 50% glycerol |
---|---|
Storage | Store at -20°C. for extended storage, conserve at -20°C or -80°C. |
Note | For research use only. |
Protein Sequence | MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSFYIQGTAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTKQSGRWGKEEEKSMPFQKGKHFELVFMVMPEHYKVVVNGSPFYEYGHRLPVQMVTHLQVDGDLELQSINFFGVQPAETKYPAMTGPPVFNPCLPYVGALQGGFTVRRTIIIKGYVLPTAKTFAINFRVGSSEDIALHINPRIGDCLVRNSYMNGSWGTEERMVAYNPFGPGQFFDLS |
Purity | >90% as determined by SDS-PAGE. |
MW | 61.5 kDa |
Source | E. coli |
Uniprot ID | O54891 |
Product Description
Recombinant mouse Galectin-6
Application Notes
Application Notes | Full length of GST-tag and expression region is 1-301aa |
---|
Reviews
Write Your Own Review