You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594833 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-7(Il7) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 15.9 kDa |
UniProt ID | P10168 |
Protein Sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Expression System | 26-154aa |
Biological Activity | The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml. |
Expression Region | 26-154aa |
Endotoxins | Less than 0.01 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoi Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 96% as determined by SDS-PAGE and HPLC. | |
14.9 kDa | |
E.Coli |
Unconjugated | |
90% | |
16.8 kDa | |
Mouse IL-7, His Tag (orb1496304) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ile 154 (Accession # Q544C8). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
35.5 kDa | |
E.Coli |
Filter by Rating