You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Il7 protein
Catalog Number: orb594833
Product Properties
| Catalog Number | orb594833 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Interleukin-7(Il7) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P10168 |
| MW | 15.9 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml. |
| Expression Region | 26-154aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoi Read more... |
| Background | Mouse interleukin-7(IL-7) is the member of hemopoi Read more... |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Images
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Similar Products
- Item 1 of 1
Mouse IL7 protein (Active) [orb359013]
> 96% as determined by SDS-PAGE and HPLC.
14.9 kDa
E.Coli
100 μg, 500 μg, 10 μg 
Mouse IL7 protein [orb707241]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
50 μg, 500 μg, 10 μgMouse IL7 Protein [orb2699339]
>90%, determined by SDS-PAGE
This protein contains the mouse IL7 (NP_032397.1) (Glu26-Ile154) was expressed and purified with an initial Met.
100 μg, 50 μgRecombinant Mouse Interleukin-7 protein(Il7) (Active) [orb1650619]
10 μg, 100 μg, 500 μg, 1 mg, 250 μg
Reviews
Mouse Il7 protein (orb594833)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review