You have no items in your shopping cart.
Mouse IL36A protein (Active)
SKU: orb359022
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rMuIL-36α at 1 µg/mL can bind recombinant murine IL-1 Rrp2 with a range of 0.15-5 µg/mL. |
| Tag | Tag-Free |
| Molecular Weight | 18.0 kDa |
| Expression Region | 1-160aa |
| Protein Length | Full Length |
| Protein Sequence | MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 5 % trehalose |
| Disclaimer | For research use only |
Alternative Names
−FIL1 epsilon, IL-1 epsilon, Interleukin-1 family member 6, IL-1F6, Interleukin-1 homolog 1
Similar Products
−Mouse IL36A protein (Active) [orb359023]
> 95% as determined by SDS-PAGE and HPLC.
17.1 kDa
E.Coli
10 μg, 100 μg, 500 μgRecombinant Mouse Interleukin-36 alpha protein(Il36a) (Active) [orb1650636]
>95% as determined by SDS-PAGE and HPLC.
17.1 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μgRecombinant Mouse Interleukin-36 alpha protein(Il36a) (Active) [orb1650637]
>95% as determined by SDS-PAGE and HPLC.
18.0 kDa
500 μg, 1 mg, 10 μg, 250 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse IL36A protein (Active) (orb359022)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
