You have no items in your shopping cart.
Mouse Il33 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-33 at 5μg/ml can bind Mouse ST2-Fc, the ED50 of Mouse ST2-Fc is 0.33 ug/ml. |
| Tag | Tag-Free |
| Molecular Weight | 17.6 kDa |
| Expression Region | 109-266aa |
| Protein Length | Partial |
| Protein Sequence | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse IL33 protein (Active) [orb359021]
> 98% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μgRecombinant Mouse IL33 Protein, C-His [orb3149092]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
19.85 kDa
50 μg, 100 μg, 1 mgIL33 Rabbit Polyclonal Antibody (Biotin) [orb447525]
IF, IHC-Fr, IHC-P
Mouse, Rat
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse Il33 protein (orb594779)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

