You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Il33 protein
Catalog Number: orb594779
| Catalog Number | orb594779 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Interleukin-33(Il33),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
| Protein Length | Partial |
| UniProt ID | Q8BVZ5 |
| MW | 17.6 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-33 at 5μg/ml can bind Mouse ST2-Fc, the ED50 of Mouse ST2-Fc is 0.33 ug/ml. |
| Expression Region | 109-266aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Inter Read more... |
| Background | Mouse Interleukin 33 (IL-33) is a 30 kDa proinflam Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse IL33 protein (Active) [orb359021]
> 98% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μg 
Mouse IL33 protein [orb391980]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
50 μg, 500 μg, 10 μg- Item 1 of 1
Mouse IL33 protein [orb80084]
FA, HPLC, SDS-PAGE
Unconjugated
> 97.0% as determined by RP-HPLC and analysis by SDS-PAGE
10 μg, 100 μg, 500 μg IRAK3 Protein, Mouse, Recombinant (His & Myc) [orb1977182]
98.00%
72.3 kDa (predicted)
500 μg, 100 μg, 20 μgRecombinant Mouse Interleukin-33 protein(Il33) (Active) [orb1650640]
10 μg, 100 μg, 1 mg, 250 μg, 500 μg
