Mouse IL17E Protein

• Catalog Number: orb80456
• Category: Proteins
• Description: Recombinant of Mouse IL17E protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Solubility (25°C): It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
• Source: Escherichia Coli
• Biological Activity: The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
• Storage: Stability: Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Buffer/Preservatives: IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.
• Alternative names: IL-25, IL-17E, IL17E, IL25, Interleukin-25.
• Note: For research use only
• Application notes: Cytokines And Growth Factors
• Expiration Date: 6 months from date of receipt.