You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb80456 |
---|---|
Category | Proteins |
Description | Recombinant of Mouse IL17E protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Buffer/Preservatives | IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Protein Sequence | VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA |
Application notes | Cytokines And Growth Factors |
Source | Escherichia Coli |
Biological Activity | The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Storage | Stability: Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
Alternative names | IL-25, IL-17E, IL17E, IL25, Interleukin-25. |
Note | For research use only |
95.80% | |
20 kDa (predicted); 30-35 kDa (reducing condition, due to glycosylation) |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
16.7 kDa | |
E.Coli |