You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594834 |
---|---|
Category | Proteins |
Description | Recombinant Mouse IL15RA Protein. |
Tag | C-terminal Fc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 45.5 kDa |
UniProt ID | Q60819 |
Protein Sequence | GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK |
Protein Length | Partial |
Source | Mammalian cell |
Expression System | Expression Region: 33-205aa. Protein Length: Partial |
Biological Activity | The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is less than 10 ng/ml. |
Expression Region | 33-205aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Interleukin-15 receptor subunit alpha;Il15ra;sIL-1 Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
44.8 kDa | |
Mouse IL-15 R alpha, Fc Tag (orb867324) is expressed from human 293 cells (HEK293). It contains AA Gly 33 - Lys 205 (Accession # Q60819-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
> 95% by SDS-PAGE. | |
KMP1659, Recombinant Mouse IL-15RA/IL-15 R alpha Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly33-Lys205) of mouse IL-15RA/IL-15 R alpha (Accession #Q60819) fused with an Fc tag at the C-terminus. |
Human Cells |
Filter by Rating