Mouse IL15RA protein

Catalog Number: orb594834

Catalog Number	orb594834
Category	Proteins
Description	Recombinant Mouse IL15RA Protein.
Tag	C-terminal Fc-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	45.5 kDa
UniProt ID	Q60819
Protein Sequence	GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Protein Length	Partial
Source	Mammalian cell
Expression System	Expression Region: 33-205aa. Protein Length: Partial
Biological Activity	The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is less than 10 ng/ml.
Expression Region	33-205aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alternative names	Interleukin-15 receptor subunit alpha;Il15ra;sIL-1 Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1659, Recombinant Mouse IL-15RA/IL-15 R alpha Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly33-Lys205) of mouse IL-15RA/IL-15 R alpha (Accession #Q60819) fused with an Fc tag at the C-terminus.

Sizes Available: 500 μg, 50 μg

Mouse Interleukin-15 Receptor Subunit Alpha protein (C-Fc) [orb311832]
Source:
Human Cells
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg

Conjugation:	Unconjugated
Purity:	90%
MW:	44.8 kDa
Source:	Mouse IL-15 R alpha, Fc Tag (orb867324) is expressed from human 293 cells (HEK293). It contains AA Gly 33 - Lys 205 (Accession # Q60819-1).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells