Mouse IL 17 A/F Protein

• Catalog Number: orb426451
• Category: Proteins
• Description: Recombinant of mouse IL 17 A/F protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Purity: Greater than 97.0% as determined by SDS-PAGE.
• Solubility (25°C): It is recommended to reconstitute the lyophilized Mouse IL17 A/F in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
• Source: Escherichia Coli
• Storage: Stability: Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Buffer/Preservatives: Lyophilized from a concentrated (1mg/ml) solution containing no additives.
• Alternative names: IL17A/F, IL17 A/F, IL-17A/F, IL-17 A/F, IL17AF, IL
• Note: For research use only
• Application notes: Cytokines And Growth Factors
• Expiration Date: 6 months from date of receipt.