Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Mouse IgG2A Fc protein
Catalog Number orb420028
ReactivityMouse
ConjugationUnconjugated
Tested applicationsSDS-PAGE
Endotoxins Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Target IgG2A Fc
Product Properties
Form/Appearance Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Storage Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Note For research use only.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Protein Sequence GGGGGSPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
Purity >95% as determined by reducing SDS-PAGE.
MW 26.6kDa
Source Human Cells
Uniprot ID P01863
Product Description

Recombinant of mouse IgG2A Fc protein

Reviews
Write Your Own Review
You're reviewing:Mouse IgG2A Fc protein - orb420028
Your Rating