Mouse Fgf2 protein

• Catalog Number: orb594760
• Category: Proteins
• Description: Recombinant Mouse Fibroblast growth factor 2(Fgf2) (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 17.15 kDa
• UniProt ID: P15655
• Protein Sequence: MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Protein Length: Full Length
• Source: E.coli
• Expression System: Expression Region: 1-154aa. Protein Length: Full Length
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-1.8 ng/ml.
• Expression Region: 1-154aa
• Endotoxins: Less than 0.01 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0
• Alternative names: Fibroblast Growth Factor 2; FGF-2; Basic Fibroblas
• Note: For research use only
• Application notes: Full Length
• Expiration Date: 6 months from date of receipt.