You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-1.8 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 1-154aa |
| Protein Length | Full Length |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 17.15 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit [orb778804]
Mouse
15.63-1000 pg/mL
4.54 pg/mL
96 T, 48 TRecombinant Mouse FGFb Protein [orb3002419]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 17.15 KDa. Observed: 16 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse FGF2/bFGF Protein, N-His [orb2964466]
ELISA, SDS-PAGE, WB
>95% as determined by SDS-PAGE.
18.50 kDa
1 mg, 50 μg, 100 μgRecombinant Mouse FGF2/bFGF Protein, C-His [orb2966608]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
17.52 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse Fgf2 protein (orb594760)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

