You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594760 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Fibroblast growth factor 2(Fgf2) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Protein Length | Full Length |
UniProt ID | P15655 |
MW | 17.15 kDa |
Application notes | Full Length |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-1.8 ng/ml. |
Expression Region | 1-154aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Fibroblast Growth Factor 2; FGF-2; Basic Fibroblas Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
20.3 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
18.9 kDa | |
Yeast |
Mouse | |
15.63-1000 pg/mL | |
4.54 pg/mL |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
> 90% as determined by SDS-PAGE. | |
18 kDa |