You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Fgf2 protein
Catalog Number: orb594760
| Catalog Number | orb594760 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Fibroblast growth factor 2(Fgf2) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Protein Length | Full Length |
| UniProt ID | P15655 |
| MW | 17.15 kDa |
| Application notes | Full Length |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-1.8 ng/ml. |
| Expression Region | 1-154aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Fibroblast Growth Factor 2; FGF-2; Basic Fibroblas Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse Fgf-2 protein [orb704601]
Greater than 90% as determined by SDS-PAGE.
20.3 kDa
E.coli
20 μg, 100 μg, 1 mg 
Mouse Fgf2 Protein [orb1476888]
Greater than 85% as determined by SDS-PAGE.
18.9 kDa
Yeast
1 mg, 20 μg, 100 μg- Item 1 of 1
Mouse Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit [orb778804]
Mouse
15.63-1000 pg/mL
4.54 pg/mL
96 T, 48 T Mouse FGF2 protein [orb391730]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Mouse FGF2/bFGF Protein, C-His [orb2831837]
> 90% as determined by SDS-PAGE.
18 kDa
100 μg, 50 μg, 20 μg
