You have no items in your shopping cart.
Mouse CXCL14 protein
SKU: orb245423
Featured
Description
Research Area
Epigenetics
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 13.4 kDa |
| Expression Region | 23-99aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−C-X-C motif chemokine 14 protein, Chaemokine, CXC motif, ligand 14 protein, Chemokine (C-X-C motif) ligand 14 protein, Chemokine BRAK protein, CXC chemokine in breast and kidney protein, CXCL 14 protein, CXCL-14 protein, CXCL14 protein, CXL14_HUMAN protein, JSC protein, Kec protein, Kidney-expressed chemokine CXC protein, KS1 protein, MGC10687 protein, MGC124510 protein, MGC90667 protein, 1110031L23Rik protein, 1200006I23Rik protein, AI414372 protein, BMAC protein, bolekine protein, MIP 2 gamma protein, MIP-2G protein, MIP2G protein, MIP2gamma protein, NJAC protein, PRO273 protein, PSEC0212 protein, Scyb14 protein, Small Inducible Cytokine B14 protein, Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK) protein, Small Inducible Cytokine subfamily B, member 14 protein, Small-inducible cytokine B14 protein, UNQ240 protein, CXC-X3 protein, BRAKKEC protein, member 14 (BRAK) protein, MIP-2 gamma protein, NJACKec protein, SCYB14MGC10687 protein
Similar Products
−Mouse CXCL14 protein [orb756384]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
8.4 kDa
E.Coli
200 μg, 50 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse CXCL14 protein (orb245423)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
