Mouse CTLA4 protein

• Catalog Number: orb594884
• Category: Proteins
• Description: Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 14.6 kDa
• UniProt ID: P09793
• Protein Sequence: AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse B7-1-Fc at 5μg/ml can bind Mouse CTLA-4-His, the ED50 of Recombinant Mouse CTLA-4-His is 2-10 ng/ml.
• Expression Region: 37-161aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Alternative names: Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymp
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.