You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594718 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Macrophage colony-stimulating factor 1(Csf1),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE |
Protein Length | Partial |
UniProt ID | P07141 |
MW | 26 kDa |
Application notes | Partial |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is 0.04-0.2 ng/ml. |
Expression Region | 33-262aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Macrophage colony-stimulating factor 1;CSF-1;MCSF; Read more... |
Background | Macrophage colony-stimulating factor 1(M-csf)is a Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 95% as determined by SDS-PAGE and HPLC. | |
26 kDa | |
E.Coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
> 90% as determined by SDS-PAGE. | |
28.28 kDa |