You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Csf1 protein
Catalog Number: orb594718
| Catalog Number | orb594718 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Macrophage colony-stimulating factor 1(Csf1),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE |
| Protein Length | Partial |
| UniProt ID | P07141 |
| MW | 26 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is 0.04-0.2 ng/ml. |
| Expression Region | 33-262aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Macrophage colony-stimulating factor 1;CSF-1;MCSF; Read more... |
| Background | Macrophage colony-stimulating factor 1（M-csf）is a Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse CSF1 protein (Active) [orb359040]
> 95% as determined by SDS-PAGE and HPLC.
26 kDa
E.Coli
10 μg, 100 μg, 500 μg 
Mouse CSF1 protein [orb391534]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgMouse CSF1 protein [orb707253]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgRecombinant Mouse CSF1/M-CSF Protein, N-His [orb2834195]
> 90% as determined by SDS-PAGE.
28.28 kDa
100 μg, 50 μg, 20 μgRecombinant Mouse Macrophage colony-stimulating factor 1 protein(Csf1) (Active) [orb1650774]
1 mg, 10 μg, 100 μg, 250 μg, 500 μg
