Mouse CD3E protein

SKU: orb383173

Description

This Mouse CD3E protein spans the amino acid sequence from region 23-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Key Properties

• Source: Yeast
• Biological Origin: Mus musculus (Mouse)
• Tag: N-terminal 6xHis-tagged
• Molecular Weight: 11.9 kDa
• Expression Region: 23-108aa
• Protein Length: Extracellular Domain
• Protein Sequence: DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

FLJ18683 Proteins, T3E Proteins, TCRE Proteins, CD3E Proteins, CD3-epsilon Proteins, CD3 epsilon Proteins, CD3E Proteins, CD3E antigen epsilon polypeptide (TiT3 complex) Proteins, CD3E antigen epsilon polypeptide Proteins, CD3E antigen Proteins, epsilon subunit Proteins, CD3E molecule epsilon Proteins, CD3E molecule Proteins, epsilon (CD3 TCR complex) Proteins, CD3E molecule Proteins, epsilon (CD3-TCR complex) Proteins, CD3E_HUMAN Proteins, IMD18 Proteins, T cell antigen receptor complex epsilon subunit of T3 Proteins, T cell surface antigen T3/Leu 4 epsilon chain Proteins, T cell surface glycoprotein CD3 epsilon chain Proteins, T-cell surface antigen T3/Leu-4 epsilon chain Proteins, T-cell surface glycoprotein CD3 epsilon chain Proteins, T3E Proteins, TCRE Proteins

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd3e.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd3e.

Quick Database Links

UniProt

P22646