Mouse CD3E protein

Catalog Number: orb383173

Catalog Number	orb383173
Category	Proteins
Description	Mouse CD3E protein
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	11.9 kDa
UniProt ID	P22646
Protein Sequence	DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Protein Length	Extracellular Domain
Source	Yeast
Expression System	Expression Region: 23-108aa. Protein Length: Extracellular Domain
Expression Region	23-108aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	FLJ18683 Proteins, T3E Proteins, TCRE Proteins, CD Read more...
Note	For research use only
Application notes	E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain
Expiration Date	6 months from date of receipt.

Item 1 of 1
Mouse CD3 epsilon Protein [orb348808]
Conjugation:
Unconjugated
Purity:
95%
MW:
36 kDa
Source:
Mouse CD3E, Fc Tag (orb348808) is expressed from human 293 cells (HEK293). It contains AA Asp 23 - Asp 108 (Accession # P22646).
Sizes Available: 100 μg, 1 mg
Mouse Cd3e Protein [orb1477998]
Purity:
Greater than 90% as determined by SDS-PAGE.
MW:
17.3 kDa
Source:
E.coli
Sizes Available: 20 μg, 100 μg, 1 mg
CD3EAP siRNA (Mouse) [orb1841085]
Applications:
RNA-I
Sizes Available: 30 nmol, 15 nmol

Purity:	> 95%by Bis-Tris PAGE, > 95%by HPLC
Source:	KMP1854, Recombinant Mouse CD3E&CD3D Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp23-Asp108(P22646)&Phe22-Ala105(P04235)) of mouse CD3E&CD3D (Accession #) fused with a hFc tag at the C-terminus.

Sizes Available: 500 μg, 100 μg

Recombinant mouse CD3E protein, C-mFc (HEK293) [orb1808061]
MW:
37.2 kDa
Sizes Available: 100 μg, 500 μg

Conjugation:	Unconjugated
Purity:	95%
MW:	36 kDa
Source:	Mouse CD3E, Fc Tag (orb348808) is expressed from human 293 cells (HEK293). It contains AA Asp 23 - Asp 108 (Accession # P22646).

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	17.3 kDa
Source:	E.coli