You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383173 |
---|---|
Category | Proteins |
Description | Mouse CD3E protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 11.9 kDa |
UniProt ID | P22646 |
Protein Sequence | DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD |
Protein Length | Extracellular Domain |
Source | Yeast |
Expression System | Expression Region: 23-108aa. Protein Length: Extracellular Domain |
Expression Region | 23-108aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | FLJ18683 Proteins, T3E Proteins, TCRE Proteins, CD Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
36 kDa | |
Mouse CD3E, Fc Tag (orb348808) is expressed from human 293 cells (HEK293). It contains AA Asp 23 - Asp 108 (Accession # P22646). |
Greater than 90% as determined by SDS-PAGE. | |
17.3 kDa | |
E.coli |
> 95%by Bis-Tris PAGE, > 95%by HPLC | |
KMP1854, Recombinant Mouse CD3E&CD3D Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp23-Asp108(P22646)&Phe22-Ala105(P04235)) of mouse CD3E&CD3D (Accession #) fused with a hFc tag at the C-terminus. |
Filter by Rating