You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419150 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Aquaporin-4 |
Tag | C-terminal 6xHis-Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV |
Protein Length | Partial |
UniProt ID | P55088 |
MW | 10.9 kDa |
Application notes | Tag Info: C-terminal Myc-tagged and C-terminal 6xHis-taggedExpression Region: 253-323aaSequence Info: Full Length |
Endotoxins | Not test. |
Source | Yeast |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 253-323aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Mercurial-insensitive water channel |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.The reducing (R) protein migrates as 16 kDa in SDS-PAGE may be due to glycosylation.Recommended Product
Greater than 85% as determined by SDS-PAGE. | |
9.9 kDa | |
Yeast |
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Greater than 85% as determined by SDS-PAGE. | |
40.5 kDa | |
in vitro E.coli expression system |
Greater than 85% as determined by SDS-PAGE. | |
34.8 kDa | |
in vitro E.coli expression system |
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
iFluor647 |