Morf4l1 Peptide - middle region

• Catalog Number: orb2009914
• Category: Proteins
• Description: Morf4l1 Peptide - middle region
• Predicted Reactivity: Mouse
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: LQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETF
• UniProt ID: P60762
• MW: 41kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with Morf4l1 Rabbit Polyclonal Antibody (orb580132). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: KIAA4002, MGC102415, MGC103105, MGC118047, MORFRG1
• Note: For research use only
• NCBI: NP_001034236
• Expiration Date: 6 months from date of receipt.