You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358906 |
---|---|
Category | Proteins |
Description | Recombinant monkey Transthyretin protein |
Tag | N-terminal 6xHis-Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE |
Protein Length | Full Length of Mature Protein |
UniProt ID | Q8HXW1 |
MW | 17.7 kDa |
Application notes | Full length of HIS-tag and expression region is 18.07kDa |
Endotoxins | Not test. |
Source | Mammalian cell |
Biological Origin | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
Expression Region | 21-147aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Amyloidosis I protein, ATTR protein, CTS protein, Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) TTR.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) TTR.
Greater than 90% as determined by SDS-PAGE. | |
29.7 kDa | |
E.coli |