You have no items in your shopping cart.
Monkey Mast Cell Chymase protein
SKU: orb383238
Featured
Description
Research Area
Epigenetics
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 41.1 kDa |
| Expression Region | 22-247aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | IIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLIRRNFVLTAVHCAGRSITVTLGAHNITEKEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWINKILQAN |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti Alpha-chymaseprotein, anti Chymase 1protein, anti Chymase 1 mast cellprotein, anti chymase 1 preproprotein transcript Eprotein, anti chymase 1 preproprotein transcript Iprotein, anti Chymaseprotein, anti Chymase, heartprotein, anti Chymase, mast cellprotein, anti CMA1protein, anti CYHprotein, anti CYMprotein, anti Mast cell chymase 1protein, anti Mast cell protease 3protein, anti Mast cell protease 5protein, anti Mast cell protease Iprotein, anti Mast cell protease IIIprotein, anti Mcp-5protein, anti MCP3Pprotein, anti Mcpt5protein, anti MCT1protein

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Monkey Mast Cell Chymase protein (orb383238)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review