Cart summary

You have no items in your shopping cart.

Monkey IL6 protein (Active)

Catalog Number: orb358999

DispatchUsually dispatched within 1-2 weeks
$ 400.00
Catalog Numberorb358999
CategoryProteins
DescriptionRecombinant monkey IL6 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered concentrated solution in 50 mM Tris-HCl, pH 9.0, 600 mM NaCl, with 0.02 % Tween-20.
Purity> 97% as determined by SDS-PAGE and HPLC.
Protein SequenceM+APVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM
Protein LengthFull Length of Mature Protein
UniProt IDP51494
MW21.1 kDa
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
SourceE.Coli
Biological OriginMacaca mulatta (Rhesus macaque)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay usingIL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg.
Expression Region28-212aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative namesInterleukin BSF 2 protein, B cell differentiation
Read more...
NoteFor research use only
Monkey IL6 protein (Active)