Cart summary

You have no items in your shopping cart.

    Monkey GPX4 protein

    Monkey GPX4 protein

    Catalog Number: orb358637

    DispatchUsually dispatched within 4-5 weeks
    $ 2,400.00
    Catalog Numberorb358637
    CategoryProteins
    DescriptionRecombinant monkey GPX4 protein
    TagN-terminal 6xHis-SUMO-tagged
    Form/AppearanceLiquid or Lyophilized powder
    PurityGreater than 90% as determined by SDS-PAGE.
    MW35 kDa
    UniProt IDQ4AEH2
    Protein SequenceMSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI
    Protein LengthPartial
    SourceE.coli
    Expression SystemExpression Region: 28-197aa(U73S). Protein Length: Partial
    Expression Region1-170aa
    EndotoxinsNot test.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
    Alternative namesGlutathione peroxidase 4 Short name, GPx-4 Short n
    Read more...
    NoteFor research use only
    Application notesThis is His-SUMO-tag protein
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars