Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Monkey GPX4 protein

SKU: orb358637

Description

This Monkey GPX4 protein spans the amino acid sequence from region 1-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Developmental Biology, Epigenetics

Images & Validation

Application Notes
This is His-SUMO-tag protein

Key Properties

SourceE.coli
Biological Originongo pygmaeus (Bornean orangutan)
TagN-terminal 6xHis-SUMO-tagged
Expression Region1-170aa
Protein LengthPartial
MW35 kDa
PurityGreater than 90% as determined by SDS-PAGE.
Protein SequenceMSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLiquid or Lyophilized powder
Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Glutathione peroxidase 4 Short name, GPx-4 Short name, GSHPx-4
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

20 μg
$ 450.00
100 μg
$ 800.00
1 mg
$ 2,610.00
DispatchUsually dispatched within 4-5 weeks
Bulk Enquiry