Cart summary

You have no items in your shopping cart.

Monkey GPX4 protein

SKU: orb358637

Description

This Monkey GPX4 protein spans the amino acid sequence from region 1-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Developmental Biology, Epigenetics

Images & Validation

Application Notes
This is His-SUMO-tag protein

Key Properties

SourceE.coli
Biological Originongo pygmaeus (Bornean orangutan)
TagN-terminal 6xHis-SUMO-tagged
Molecular Weight35 kDa
Expression Region1-170aa
Protein LengthPartial
Protein SequenceMSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI
PurityGreater than 90% as determined by SDS-PAGE.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLiquid or Lyophilized powder
Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Glutathione peroxidase 4 Short name, GPx-4 Short name, GSHPx-4
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Monkey GPX4 protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Monkey GPX4 protein (orb358637)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 410.00
100 μg
$ 750.00
1 mg
$ 2,490.00
DispatchUsually dispatched within 4-5 weeks
Bulk Enquiry