You have no items in your shopping cart.
Cart summary
Monkey CCL8 protein
Catalog Number: orb1215683
| Catalog Number | orb1215683 |
|---|---|
| Category | Proteins |
| Description | The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)) (Gene ID: 102137164). |
| Target | CCL8 |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77) |
| Protein Length | 77 |
| MW | 9.0 kDa |
| Source | Yeast |
| Biological Origin | Monkey |
| Storage | -20°C |
| Note | For research use only |
