Cart summary

You have no items in your shopping cart.

MOB3C Peptide - middle region

MOB3C Peptide - middle region

Catalog Number: orb2004866

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2004866
CategoryProteins
DescriptionMOB3C Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: MAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRV
UniProt IDQ70IA8
MW25kDa
Tested applicationsWB
Application notesThis is a synthetic peptide designed for use in combination with MOB3C Rabbit Polyclonal Antibody (orb587533). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesMOB1E, MOBKL2C
NoteFor research use only
NCBINP_958805