MLX Rabbit Polyclonal Antibody

• Catalog Number: orb329724
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MLX
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MLX
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: MLX
• UniProt ID: Q9UH92
• Protein Sequence: Synthetic peptide located within the following region: AYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEA
• NCBI: NP_733752
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MAD7 antibody, anti MXD7 antibody, anti TCFL4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-MLX Antibody, Catalog Number: orb329724, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

Rabbit Anti-MLX Antibody, Catalog Number: orb329724, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in endothelial cells in sinusoids, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-MLX Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Transfected 293T.