MIXL1 Rabbit Polyclonal Antibody

• Catalog Number: orb573570
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MIXL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MIXL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25 kDa
• Target: MIXL1
• UniProt ID: Q9H2W2
• Protein Sequence: Synthetic peptide located within the following region: MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA
• NCBI: NP_114150
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MIX, MIXL, MILD1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Two isoforms at 25 kDa and 26 kDa contain the peptide sequence. The protein may be phosphorylated.

WB Suggested Anti-MIXL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.