You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573570 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MIXL1 |
Target | MIXL1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MIXL1 |
Protein Sequence | Synthetic peptide located within the following region: MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA |
UniProt ID | Q9H2W2 |
MW | 25 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MIX, MIXL, MILD1 |
Note | For research use only |
NCBI | NP_114150 |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Two isoforms at 25 kDa and 26 kDa contain the peptide sequence. The protein may be phosphorylated.
WB Suggested Anti-MIXL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.
WB | |
Bovine, Equine, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |