MICALL1 Rabbit Polyclonal Antibody

• Catalog Number: orb581401
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MICALL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Goat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MICALL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 93kDa
• Target: MICALL1
• UniProt ID: Q8N3F8
• Protein Sequence: Synthetic peptide located within the following region: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP
• NCBI: NP_203744
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MIRAB13, MICAL-L1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. MICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. MICALL1 is supported by BioGPS gene expression data to be expressed in HepG2.

Positive control (+): Human Placenta (PL), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 0.5 ug/ml.

Rabbit Anti-MICALL1 Antibody, Catalog Number: orb581401, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.