You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1999597 |
|---|---|
| Category | Proteins |
| Description | MFGE8 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: KEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPG |
| UniProt ID | Q08431 |
| MW | 35 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | BA46, HMFG, MFGM, SED1, hP47, EDIL1, MFG-E8, SPAG1 Read more... |
| Note | For research use only |
| NCBI | NP_001108086.1 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review