MEDAG antibody

• Catalog Number: orb326838
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MEDAG
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Equine, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MEDAG
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: MEDAG
• UniProt ID: Q5VYS4
• Protein Sequence: Synthetic peptide located within the following region: MLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESY
• NCBI: NP_116238
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AWMS3 antibody, anti hAWMS3 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Haixia Liu 1, Zhiyue Chang 2, Shuling Liu 3, Ruyuan Zhu 1, Jiayi Ma 1, Xinyue Lu 1, Lei Li 3, Zhiguo Zhang MEDAG expression in vitro and paeoniflorin alleviates bone loss by regulating the MEDAG/AMPK/PPARγ signaling pathway in vivo Heliyon, 10, e24241 (2024)

PubMed: 38226230

Applications

IHC, WB

Reactivity

Mouse

Western blot analysis of human HepG2 tissue using MEDAG antibody