MDM2 Rabbit Polyclonal Antibody

SKU: orb588417

Description

Rabbit polyclonal antibody to MDM2

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MDM2
• Target: MDM2
• Protein Sequence: Synthetic peptide located within the following region: EISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKA
• Molecular Weight: 55 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HDMX, LSKB, hdm2, ACTFS

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: Fetal Kidney lysates, Antibody Dilution: 1.0 ug/ml.

MDM2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb588417 with 1:200 dilution. Western blot was performed using orb588417 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: MDM2 IP with orb588417 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-MDM2 Antibody, Catalog Number: orb588417, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

MDM2

UniProt

Q00987