You have no items in your shopping cart.
mCRAMP (mouse)
SKU: orb1147088
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 3878.7 Da |
|---|---|
| Protein Sequence | H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH |
| Purity | > 95% by HPLC |
Storage & Handling
−| Storage | Store dry, frozen and desiccated |
|---|---|
| Form/Appearance | Freeze dried solid |
| Disclaimer | For research use only |
Alternative Names
−Mouse calethicidin related antimicrobial peptide, antimicrobial activityAM040, GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH, mCRAMP (mouse) or mouse cathelicidin-related antimicrobial peptide, murine cathelicidin
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
mCRAMP (mouse) (orb1147088)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days