Cart summary

You have no items in your shopping cart.

mCRAMP (mouse)

SKU: orb1147088

Description

Sole murine cathelicidin and homologue of human LL 37; Antibacterial; Antiviral; Antimicrobial peptides.

Research Area

Infectious Disease & Virology

Images & Validation

Key Properties

Molecular Weight3878.7 Da
Protein SequenceH-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
Purity> 95% by HPLC

Storage & Handling

StorageStore dry, frozen and desiccated
Form/AppearanceFreeze dried solid
DisclaimerFor research use only

Alternative Names

Mouse calethicidin related antimicrobial peptide, antimicrobial activityAM040, GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH, mCRAMP (mouse) or mouse cathelicidin-related antimicrobial peptide, murine cathelicidin

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

mCRAMP (mouse) (orb1147088)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
$ 330.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry