You have no items in your shopping cart.
Cart summary
MCHR1 Peptide - C-terminal region
Catalog Number: orb2000216
Product Properties
| Catalog Number | orb2000216 |
|---|---|
| Category | Proteins |
| Description | MCHR1 Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: SCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT |
| UniProt ID | Q5IFH6 |
| MW | 32 kDa |
| Application notes | This is a synthetic peptide designed for use in combination with MCHR1 Rabbit Polyclonal Antibody (orb589671). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | SLC1, GPR24, MCH1R, SLC-1, MCH-1R |
| Note | For research use only |
| NCBI | NP_005288.3 |
Images
Reviews
MCHR1 Peptide - C-terminal region (orb2000216)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review