You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586702 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MBOAT4 |
Target | MBOAT4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MBOAT4 |
Protein Sequence | Synthetic peptide located within the following region: FKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRIS |
UniProt ID | Q96T53 |
MW | 36kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | GOAT, OACT4, FKSG89 |
Note | For research use only |
Sample Type: MDA-MB-435S Whole cell lysates, Antibody dilution: 1.0 ug/ml.
IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Monkey, Primate, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Canine, Equine, Human, Monkey, Primate, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy3 |
IF | |
Canine, Equine, Human, Monkey, Primate, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |