Cart summary

You have no items in your shopping cart.

MBD3L1 Rabbit Polyclonal Antibody (FITC)

MBD3L1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2090766

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090766
CategoryAntibodies
DescriptionMBD3L1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human MBD3L1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW21kDa
UniProt IDQ8WWY6
Protein SequenceSynthetic peptide located within the following region: CKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEK
NCBINP_660209
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMBD3L
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.