You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2009998 |
---|---|
Category | Proteins |
Description | March2 Peptide - middle region |
Tested applications | WB |
Predicted Reactivity | Human, Mouse |
Form/Appearance | Lyophilized powder |
MW | 32kDa |
UniProt ID | Q8CA25 |
Protein Sequence | LAAISGWLCLRGAQDHLRLHSRLEAVGLIALTIALFTIYVLWTLVSFRYH |
NCBI | NP_663461 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | 9530046H09Rik, MGC7259, MARCH-II Read more... |
Note | For research use only |
Application notes | This is a synthetic peptide designed for use in combination with MARCH2 Rabbit Polyclonal Antibody (orb55672). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Expiration Date | 6 months from date of receipt. |