Cart summary

You have no items in your shopping cart.

MAPK8IP2 Peptide - middle region

MAPK8IP2 Peptide - middle region

Catalog Number: orb1999611

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999611
CategoryProteins
DescriptionMAPK8IP2 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW90 kDa
UniProt IDQ13387
Protein SequenceSynthetic peptide located within the following region: SEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNL
NCBINP_036456.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesIB2, IB-2, JIP2, PRKM8IPL
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.