Cart summary

You have no items in your shopping cart.

MAP2K4 Peptide - N-terminal region

MAP2K4 Peptide - N-terminal region

Catalog Number: orb2000207

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2000207
CategoryProteins
DescriptionMAP2K4 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: AAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANP
UniProt IDP45985
MW43 kDa
Application notesThis is a synthetic peptide designed for use in combination with MAP2K4 Rabbit Polyclonal Antibody (orb589711). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesJNKK, MEK4, MKK4, SEK1, SKK1, JNKK1, SERK1, MAPKK4
Read more...
NoteFor research use only
NCBINP_001268364.1