You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215661 |
---|---|
Category | Proteins |
Description | The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). |
Target | M-CSF |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162) |
Protein Length | 162 |
MW | 18.8 kDa |
Source | Yeast |
Biological Origin | Bat |
Storage | -20°C |
Note | For research use only |