You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579682 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MAGEA3 |
Target | MAGEA3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MAGEA3 |
Protein Sequence | Synthetic peptide located within the following region: APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD |
UniProt ID | P43357 |
MW | 35kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HIP8, HYPD, CT1.3, MAGE3, MAGEA6 |
Note | For research use only |
NCBI | NP_005353 |
Testis
WB Suggested Anti-MAGEA3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Liver.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Human | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |