You have no items in your shopping cart.
Cart summary
LSM1 Peptide - middlel region
Catalog Number: orb1997682
| Catalog Number | orb1997682 |
|---|---|
| Category | Proteins |
| Description | LSM1 Peptide - middlel region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: LRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENV |
| UniProt ID | Q8VC85 |
| MW | 14 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CASM, 2810025O06Rik |
| Note | For research use only |
| NCBI | NP_080308.1 |
