You have no items in your shopping cart.
LNX2 Peptide - middle region
SKU: orb2003097
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Application Notes |
Key Properties
−| Molecular Weight | 75kDa |
|---|---|
| Protein Sequence | Synthetic peptide located within the following region: LRERRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGV |
Storage & Handling
−| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Disclaimer | For research use only |
Alternative Names
−LNX2,PDZRN1,

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
LNX2 Peptide - middle region (orb2003097)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review