Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

LL 37 (human), 5-FAM

SKU: orb1140566

Description

N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37; Fluorescent labelled peptides.

Images & Validation

Key Properties

MW4963.6 Da
Purity> 95% by HPLC
FormulaC226H351N61O58
Protein Sequence5-FAM-Ahx-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Storage & Handling

StorageStore dark, frozen and desiccated
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

5-FAM AM004, LL 37 (human), LL37, [LL-37, 37 aa], carboxyfluoresceinated, fluorescent detection, host defence peptide LL 37

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

LL 37 (human), 5-FAM (orb1140566)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

0.1 mg
$ 210.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry